HOME > TRADE LEADS > NEW TREAD LEADS  
Total 3,678 tread leads found
Browse by Categories
  View by :  All     Buy     Sell     Biz   (346 ~ 360 of 3,678) 
 
   Sell HGH Fragment 176-191/AOD9604/HGH Frag
WHOLE SALE: Human Growth Hormone, HGH, IGF-1 LR3, HCG, HGH fragment 176-191, CJC-1295, CJC-1295 with DAC,GHRP-2, GHRP-6, Hexarelins, Ipamorelin, Melanotan II, MT-II, Sermorelin, PT-141, TB-500, Thymosin Beta 4, Selank, DSIP etc. You can specify the ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell GHRP-2/GHRP2
Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula: C45H55N9O6 Molar Mass: 817.9 CAS number: 158861-67-7 PubChem: CID 6918245 Synonyms: Growth Hormone Releasing Peptide-2; GHRP2; GHRP 2 Growth Hormone Releasing Peptides (GHRP-2, GHRP-6 ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell High Quality HGH,/Human Growth Hormone
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell IGF-1 LR3
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 Active chemical substance: IGF-1 long R3. The hypothesis that the ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell HGH Blue Top,HGH191AA,10iu
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Human Growth Hormone
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth,cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of cells. ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Sermorelin
Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Sermorelin free sample
Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Human Growth Hormone 191aa
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell HGH
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth,cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of cells. ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Sermorelin 2mg
Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Human Growth Hormone 10iu
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell Blue Top Human Growth Hormone
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell HGH Blue Top,Red Top,Green Top,Human Growth ...
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
 
   Sell IGF-1 LR3 1mg/Vial
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 Active chemical substance: IGF-1 long R3. The hypothesis that the ...
Ghormone Biotech Co.,Ltd.    China    (2015/02/01)
[14] [15] [16] [17] [18] [19] [20] [21] [22] [23] [24] [25] [26] [27] [28] [29] [30] [31] [32] [33]