HOME > TRADE LEADS > NEW TREAD LEADS  
Total 5,564 tread leads found
Browse by Categories
  View by :  All     Buy     Sell     Biz   (91 ~ 105 of 5,564) 
 
   Sell New Low Profile Servo XQ-S3008D for RC ...
New Low Profile Servo XQ-S3008D for RC aircraft Size:A:40.2mm B:20.1mm C:29.4mm D:48.0mm E:10mm Weight:48.5g (1.71oz) Speed:0.09sec /4.8V 0.07sec /6.0V Torque:(97 oz-in)7kg /4.8V (118 oz-in)8.5kg /6.0V Voltage:4.8V-6.0V Features:Titanium ...
Shenzhen Xq-power Model Electronics Co., Ltd    China    (2015/03/31)
 
   Sell TITAN 125/150, YBR125/FAZER CYLINDER
Offering OEM quality cylinder for Chinese motorcycles, and Oversea motorcycles. JH70 C90 JH90 C100 AX100 DY100/ GY6 100/ YBR125/ C110/AT110 CG110/FT110 JY110/CRYPTON CG125 83...91/CG CARGO/CG TODAY/TITAN 125 FAN/FT125/SPEED125 CB125 CBT125/ GS125 ...
Chongqing Kailian Group    China    (2015/03/31)
 
   Sell sell 0.7-12 mm Automatic Seed Counter
Features: 1. Microcomputer control,completely automatic operation 2. Count speed is adjustable,high accuracy,metal shell,and elegant appearance 3.Both round and long seeds 0.7-12mm are suitable 4.LED display read the quantity directly 5.Count NO ...
Linan Horti-king Technology Co.Ltd    China    (2015/03/31)
 
   Sell brake drum 43512-4100 for HINO auto spare ...
1, Standard for casting is G3000. Standard for machining is SAE-J431. 2, We exported to North-America, Western Europe, Eastern Europe, Middle-East, Asian areas and other countries. 3, All typical brake drums for trucks and automobile, such as WEBB / ...
Longyao Changjian Auto Parts Co.,Ltd    China    (2015/03/31)
 
   Sell Jacobs Kronung 500 g ground coffee
round coffee 60 pallets x 720 units German origin Regular deliveries Product is available ExW Warsaw, Poland Price will be supplied on inquiry
Mitmar Protein LTD    Denmark    (2015/03/31)
 
   Sell Safety Grating
This Safety Grating is salutary products because bump shape is protected slip down. Also if you want to other size products, we can make that. Company profile Establish in 1982, KUMGOK STEEL INDUSTRY CO., Ltd. As specialty suppliers of steel ...
Kumgok Steel Industry Co.,Ltd.    Korea    (2015/03/31)
 
   Sell HINO semi-trailer brake drum 43512-4690ailer
1, Standard for casting is G3000. Standard for machining is SAE-J431. 2, We exported to North-America, Western Europe, Eastern Europe, Middle-East, Asian areas and other countries. 3, All typical brake drums for trucks and automobile, such as WEBB / ...
Longyao Changjian Auto Parts Co.,Ltd    China    (2015/03/31)
 
   Sell Cast Iron Surface Plate
We are professional specializing in manufacturing and exporting all kinds ofcast iron plates with the standard of JJG 117 2005 (Chinese standard for surfaceplates) and DIN876, India Standards, ect, such as: 1. Cast Iron T-slot Floor Tables; 2. Cast ...
Jinggong Measuring Tools Co., Ltd Exporting Department    China    (2015/03/31)
 
   Sell IGF-1 LR3
The hypothesis that the insulin-like growth factor in its biological effect serves as an agent of the well-known somatotropichormone was proposed in 1957 by two scientists: Salmon and Daughaday. During the following years after identification and ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell Sermorelin
Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell IGF-1 Long R3
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 Active chemical substance: IGF-1 long R3. The hypothesis that the ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell HGH Growth Hormone Jintropin
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell top quality HGH Human Growth Hormone
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell high purity Human growth hormone
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
 
   Sell HGH Growth Hormone Jintropin
Growth hormone (GH or HGH), also known as somatotropin or somatropin, is a peptide hormone that stimulatesgrowth, cell reproduction and regeneration in humans and other animals. It is a type of mitogen which is specific only to certain kinds of ...
Ghormone Biotech Co.,Ltd.    China    (2015/03/31)
[1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [13] [14] [15] [16] [17] [18] [19] [20]